PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011087493.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 326aa    MW: 36303.4 Da    PI: 4.8802
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011087493.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17.1e-092562892255
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yp++ee+  L++k+gL+++q+ +WF N+R ++
  XP_011087493.1 256 WPYPTEEEKNWLSEKTGLDQKQINNWFINQRKRH 289
                     69*****************************885 PP

2ELK38.72e-13209230122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++L+rKYsgyL+sL++EF+
  XP_011087493.1 209 ELKEMLMRKYSGYLSSLRKEFL 230
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.8E-2161105IPR005540KNOX1
PfamPF037909.6E-2163103IPR005540KNOX1
SMARTSM012564.4E-23108159IPR005541KNOX2
PfamPF037911.7E-23111158IPR005541KNOX2
PfamPF037892.1E-10209230IPR005539ELK domain
PROSITE profilePS5121311.383209229IPR005539ELK domain
SMARTSM011883.1E-7209230IPR005539ELK domain
PROSITE profilePS5007112.487229292IPR001356Homeobox domain
SuperFamilySSF466898.55E-19231300IPR009057Homeodomain-like
SMARTSM003894.0E-12231296IPR001356Homeobox domain
CDDcd000864.27E-15232293No hitNo description
Gene3DG3DSA:1.10.10.602.0E-25234294IPR009057Homeodomain-like
PfamPF059207.3E-16249288IPR008422Homeobox KN domain
PROSITE patternPS000270267290IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MDELYRFQYS SISCPVDSNF LGDGSSSSGI IAGLSDHHNL VLTAPRAAET HEEATALEMS  60
DIIKAQIASH PLYPTLLSAY IECRKVGAPP EMASLLEEIS KETHPMPTCT HIGIDPELDD  120
FMKSYCEVLH KYKEELSKPF DEATSFLSSI ESQLSDLCKE TLPSPSPTSY SSYHSADDGG  180
GPSDEDPSCG ELEALGSQES TGNRQGDHEL KEMLMRKYSG YLSSLRKEFL QKRKKGKLPK  240
DARTALLEWW NTHYRWPYPT EEEKNWLSEK TGLDQKQINN WFINQRKRHW RPSEDMRFAL  300
MEGVSGGANA GSVYFDAGGG TGGVGT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087493.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-110KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0E3TKF51e-146A0A0E3TKF5_9ERIC; Knotted-like 6 protein
STRINGVIT_14s0060g01180.t011e-131(Vitis vinifera)
STRINGSolyc01g100510.2.11e-131(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-79KNOTTED1-like homeobox gene 6